The Global Female Civility Leadership Institute

What The Global Female Civility Leadership Institute does

The Global Female Civility Leadership Institute is a non-profit organization founded in 2018 and headquartered in Garland, United States, that states it provides executive coaching and a female leadership degree program. Per the available firmographic data, the organization operates with an 11-50 employee headcount and runs under a non-profit corporate structure, with no public listing or ticker. No product portfolio, curriculum details, technology stack, pricing, customer roster, partnerships, funding history, or management team information was disclosed in the source data.

The source material further indicates a significant content integrity concern: the website listed for the organization (theglobalfemalecivilityleadershipinstitute.org) displays Indonesian-language Togel Hongkong lottery content rather than material about female leadership or civility training. This suggests the domain may be compromised, redirected, parked, or repurposed, and means no first-party web content is available to corroborate the firm's claimed mission, service offering, or go-to-market. As a result, the business model — whether tuition-based, donation-funded, cohort-based, or a hybrid — cannot be verified from the input, and there are no confirmed customer segments, pricing mechanics, or distribution channels tied to the stated mission.

Name

The Global Female Civility Leadership Institute

Website

https://theglobalfemalecivilityleadershipinstitute.org

Company type

Private

Founded year

2018

Operating status

Operating

Headcount range

11–50 employees

Short description

The Global Female Civility Leadership Institute is a non-profit founded in 2018 in Garland, United States, that states it delivers executive coaching and a female leadership degree program; no verifiable product, pricing, or customer details are available in the source data.

Ownership category

akta.pro rank

Product category

Leadership Development Services

NAICS

Professional and Management Development Training (61143), Human Rights Organizations (813311)

SIC

Services-Educational Services (8200)

akta.pro primary industry

DEI, Inclusive Leadership & Cultural Intelligence Coaching (EDABANAJ)

akta.pro secondary industries

Inclusive Leadership & Leading Diverse Teams (EDABAAAM), Human Resources, Organizational Behavior & Leadership Institutes (EDAHAHAG), Gender Equality & Women’s Rights (BPADAGAF)

Keywords

• Executive coaching
• Women's leadership
• Leadership development
• Professional development
• Civility training

Headquarters

HQ city

Garland

HQ country

United States

HQ region

North America

Markets served

GTM type

B2B

Offering type

Services

Cost components

Personnel, Operations, Marketing or Sales

Distribution channels1 record

Marketing channels2 records

Core offering

The Global Female Civility Leadership Institute is a non-profit organization that delivers executive coaching services and a female leadership degree program. Its focus is on advancing civility and leadership capabilities among women through structured educational and coaching offerings. The institute was founded in 2018 and is headquartered in Garland, United States, operating with a small team of 11-50 staff.

Product overview

The website content does not align with the stated company name "The Global Female Civility Leadership Institute." The actual website content is about Toto HK/lottery gambling services (Togel Hongkong), providing lottery result data, not about female leadership development or civility training. No coherent product or service offerings related to the stated company were found in the source material.

Differentiator

Problem solved

Functional benefit

Products and services

• Executive Coaching
• Female Leadership Degree Program

Segments1 record

Ideal customer profiles2 records

API detail

Has API

No

API docs

API detail

Core technology

AI maturity

App detail

Recent moves1 record

Direct peers

• iPEC Coaching: An executive coaching training and certification organization delivering coach training programs and leadership development. Comparable as a direct competitor in executive coaching credentials and corporate leadership programs.
• Lean In Foundation: Founded by Sheryl Sandberg to empower women to achieve their ambitions through Circles, education, and research. Directly comparable as a non-profit delivering women's leadership programming at scale.
• Dare to Lead (Brené Brown): Research-based leadership and courage training program, widely adopted by organizations to develop inclusive, courageous leaders. Comparable as a premium leadership training brand built around a single recognized methodology.
• Simmons University Institute for Inclusive Leadership: University-based institute offering executive education and leadership programs with a strong focus on women's leadership and inclusive leadership. Comparable as a credentialed provider of women's leadership programming.
• Catalyst: A leading global non-profit focused on advancing women in leadership through research, advisory, and inclusion training. Highly comparable as a mission-aligned women's-leadership non-profit operating in the same category as The Global Female Civility Leadership Institute.
• Women's Leadership Coaching Institute: Specialized coaching firm offering certifications and programs targeted at women's leadership development. Comparable as a niche coaching organization in women's leadership, similar size and specialty as the subject.
• Forte Foundation: Non-profit focused on launching women into business leadership via education and community. Comparable as a women's-leadership education and development organization serving individuals and institutional partners.

Broad incumbents

• Korn Ferry: Global organizational consulting firm with a leadership development and executive coaching practice. Comparable as a broader incumbent that competes for the same executive-development budgets the institute is targeting.
• Center for Creative Leadership: A top global provider of executive leadership development, coaching, and research with programs touching civility, inclusion, and women-in-leadership. Comparable as a broader incumbent delivering executive coaching and leadership training.
• International Coaching Federation (ICF): The leading global organization for professional coaching, providing credentialing, standards, and community for executive coaches. Comparable as the umbrella body that sets quality and ethics standards for the executive coaching services the institute sells.

Market position

Strengths4 records

Weaknesses5 records

Competitive moat1 record

Key risks6 records

Key highlights4 records

Customer concentration

• Facebookfacebook.com/FemaleCivilityLeadershipInstitute

Revenue estimate

Valuation estimate

Number of profiles

Funding overview

Funding rounds

Investors

Funding detail is available on the Subscription and Enterprise plan.Contact sales →

M&A

Investments

M&A and investment is available on the Subscription and Enterprise plan.Contact sales →

Frequently asked questions about The Global Female Civility Leadership Institute